SCOP 1.73: Domain d1yxba1: 1yxb A:4-91

Lineage for d1yxba1 (1yxb A:4-91)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.204: all-alpha NTP pyrophosphatases [101385] (1 superfamily)
   multihelical: dimeric 4-helical bundle surrounded by other helices; oligomerizes further in a tetramer

4. Superfamily a.204.1: all-alpha NTP pyrophosphatases [101386] (4 families)
   basic module consist of 5 active site-forming helices; four from one subunit/structural repeat; the fifth from the other subunit/repeat

5. Family a.204.1.4: HisE-like (PRA-PH) [140797] (1 protein)
   Pfam PF01503

6. Protein Phosphoribosyl-ATP pyrophosphatase HisE [140798] (4 species)

7. Species Streptomyces coelicolor [TaxId:1902] [140799] (1 PDB entry)

8. Domain d1yxba1: 1yxb A:4-91 [124175]

Details for d1yxba1

PDB Entry: 1yxb, 2.6 Å

PDB Description: Crystal structure of Phosphoribosyl-ATP pyrophosphatase from Streptomyces coelicolor. NESG target RR8.

PDB Compounds: (A:) Phosphoribosyl-ATP pyrophosphatase

SCOP Domain Sequences for d1yxba1:

Sequence, based on SEQRES records:

>d1yxba1 a.204.1.4 (A:4-91) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]}
ktfeelftelqhkaangdpatsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaae
eisqllyhvqvmmvargislddvyahll

Sequence, based on observed residues (ATOM records):

>d1yxba1 a.204.1.4 (A:4-91) Phosphoribosyl-ATP pyrophosphatase HisE {Streptomyces coelicolor [TaxId: 1902]}
ktfeelftelqhkaantsrtaelvdkgvhaigkkvveeaaevwmaaeyegkdaaaeeisq
llyhvqvmmvargislddvyahll

Timeline for d1yxba1:

• d1yxba1 is new in SCOP 1.73
  
• d1yxba1 appears in SCOP 1.75
  
• d1yxba1 appears in the current release, SCOPe 2.08