SCOPe 2.02: Domain d1ywaa_: 1ywa A:

Lineage for d1ywaa_ (1ywa A:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.60: Lipocalins [50813] (1 superfamily)
   barrel, closed or opened; n=8, S=12; meander

4. Superfamily b.60.1: Lipocalins [50814] (10 families)
   bind hydrophobic ligands in their interior

5. Family b.60.1.1: Retinol binding protein-like [50815] (22 proteins)
   barrel, closed; n=8, S=12, meander

6. Protein Nitrophorin 4 [50845] (1 species)

7. Species Rhodnius prolixus [TaxId:13249] [50846] (42 PDB entries)
   Uniprot Q94734 22-205

8. Domain d1ywaa_: 1ywa A: [124140]
   automated match to d1d2ua_
   complexed with cmo, hem, po4

Details for d1ywaa_

PDB Entry: 1ywa, 0.89 Å

PDB Description: 0.9 A Structure of NP4 from Rhodnius Prolixus complexed with CO at pH 5.6

PDB Compounds: (A:) Nitrophorin 4

SCOPe Domain Sequences for d1ywaa_:

Sequence; same for both SEQRES and ATOM records:

>d1ywaa_ b.60.1.1 (A:) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

Timeline for d1ywaa_:

• d1ywaa_ first appeared in SCOP 1.73, called d1ywaa1
  
• d1ywaa_ appears in SCOPe 2.01
  
• d1ywaa_ appears in SCOPe 2.03
  
• d1ywaa_ appears in the current release, SCOPe 2.08