Lineage for d1ywaa1 (1ywa A:1-184)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 673645Fold b.60: Lipocalins [50813] (1 superfamily)
    barrel, closed or opened; n=8, S=12; meander
  4. 673646Superfamily b.60.1: Lipocalins [50814] (8 families) (S)
    bind hydrophobic ligands in their interior
  5. 673647Family b.60.1.1: Retinol binding protein-like [50815] (20 proteins)
    barrel, closed; n=8, S=12, meander
  6. 673811Protein Nitrophorin 4 [50845] (1 species)
  7. 673812Species Rhodnius prolixus [TaxId:13249] [50846] (31 PDB entries)
  8. 673815Domain d1ywaa1: 1ywa A:1-184 [124140]
    automatically matched to d1d2ua_
    complexed with cmo, hem, po4

Details for d1ywaa1

PDB Entry: 1ywa (more details), 0.89 Å

PDB Description: 0.9 A Structure of NP4 from Rhodnius Prolixus complexed with CO at pH 5.6
PDB Compounds: (A:) Nitrophorin 4

SCOP Domain Sequences for d1ywaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ywaa1 b.60.1.1 (A:1-184) Nitrophorin 4 {Rhodnius prolixus [TaxId: 13249]}
actknaiaqtgfnkdkyfngdvwyvtdyldlepddvpkrycaalaagtasgklkealyhy
dpktqdtfydvselqveslgkytanfkkvdkngnvkvavtagnyytftvmyaddssalih
tclhkgnkdlgdlyavlnrnkdaaagdkvksavsaatlefskfistkenncaydndslks
lltk

SCOP Domain Coordinates for d1ywaa1:

Click to download the PDB-style file with coordinates for d1ywaa1.
(The format of our PDB-style files is described here.)

Timeline for d1ywaa1: