Lineage for d1yvpb2 (1yvp B:364-537)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1378146Fold c.62: vWA-like [53299] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest
  4. 1378147Superfamily c.62.1: vWA-like [53300] (6 families) (S)
  5. 1378326Family c.62.1.5: RoRNP C-terminal domain-like [142565] (1 protein)
  6. 1378327Protein 60-kda SS-A/Ro ribonucleoprotein, RoRNP [142566] (1 species)
  7. 1378328Species African clawed frog (Xenopus laevis) [TaxId:8355] [142567] (3 PDB entries)
    Uniprot P42700 364-537
  8. 1378331Domain d1yvpb2: 1yvp B:364-537 [124111]
    Other proteins in same PDB: d1yvpa1, d1yvpb1
    automated match to d1yvpa2
    protein/RNA complex; complexed with act, mg

Details for d1yvpb2

PDB Entry: 1yvp (more details), 2.2 Å

PDB Description: Ro autoantigen complexed with RNAs
PDB Compounds: (B:) 60-kDa SS-A/Ro ribonucleoprotein

SCOPe Domain Sequences for d1yvpb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvpb2 c.62.1.5 (B:364-537) 60-kda SS-A/Ro ribonucleoprotein, RoRNP {African clawed frog (Xenopus laevis) [TaxId: 8355]}
veptgkrfllaidvsasmnqrvlgsilnasvvaaamcmlvartekdshmvafsdemlpcp
itvnmllhevvekmsditmgstdcalpmlwaqktntaadifivftdcetnvedvhpatal
kqyrekmgipaklivcamtsngfsiadpddrgmldicgfdsgaldvirnftldl

SCOPe Domain Coordinates for d1yvpb2:

Click to download the PDB-style file with coordinates for d1yvpb2.
(The format of our PDB-style files is described here.)

Timeline for d1yvpb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yvpb1