Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) division into families based on beta-sheet topologies |
Family c.37.1.8: G proteins [52592] (79 proteins) core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest |
Protein Rab-22a [142253] (1 species) |
Species Mouse (Mus musculus) [TaxId:10090] [142254] (2 PDB entries) Uniprot P35285 2-167! Uniprot P35285 2-168 |
Domain d1yvda1: 1yvd A:2-167 [124095] complexed with gnp, mg |
PDB Entry: 1yvd (more details), 1.93 Å
SCOPe Domain Sequences for d1yvda1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yvda1 c.37.1.8 (A:2-167) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]} slrelkvcllgdtgvgkssivwrfvedsfdpninptigasfmtktvqyqnelhkfliwdt agqerfralapmyyrgsaaaiivyditkeetfstlknwvrelrqhgppsivvaiagnkcd ltdvrevmerdakdyadsihaifvetsaknaininelfieisrrip
Timeline for d1yvda1: