Lineage for d1yvda1 (1yvd A:3-167)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2865683Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2865684Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) (S)
    division into families based on beta-sheet topologies
  5. 2866675Family c.37.1.8: G proteins [52592] (81 proteins)
    core: mixed beta-sheet of 6 strands, order 231456; strand 2 is antiparallel to the rest
  6. 2867357Protein Rab-22a [142253] (1 species)
  7. 2867358Species Mouse (Mus musculus) [TaxId:10090] [142254] (2 PDB entries)
    Uniprot P35285 2-167! Uniprot P35285 2-168
  8. 2867360Domain d1yvda1: 1yvd A:3-167 [124095]
    Other proteins in same PDB: d1yvda2
    complexed with gnp, mg

Details for d1yvda1

PDB Entry: 1yvd (more details), 1.93 Å

PDB Description: GppNHp-Bound Rab22 GTPase
PDB Compounds: (A:) Ras-related protein Rab-22A

SCOPe Domain Sequences for d1yvda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yvda1 c.37.1.8 (A:3-167) Rab-22a {Mouse (Mus musculus) [TaxId: 10090]}
lrelkvcllgdtgvgkssivwrfvedsfdpninptigasfmtktvqyqnelhkfliwdta
gqerfralapmyyrgsaaaiivyditkeetfstlknwvrelrqhgppsivvaiagnkcdl
tdvrevmerdakdyadsihaifvetsaknaininelfieisrrip

SCOPe Domain Coordinates for d1yvda1:

Click to download the PDB-style file with coordinates for d1yvda1.
(The format of our PDB-style files is described here.)

Timeline for d1yvda1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yvda2