SCOP 1.75: Domain d1yvba1: 1yvb A:0-212

Lineage for d1yvba1 (1yvb A:0-212)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.1: Papain-like [54002] (25 proteins)

6. Protein Falcipain 2 [142846] (1 species)

7. Species Plasmodium falciparum [TaxId:5833] [142847] (3 PDB entries)
   Uniprot Q9N6S8 244-484

8. Domain d1yvba1: 1yvb A:0-212 [124092]
   Other proteins in same PDB: d1yvbi1
   complexed with gol

Details for d1yvba1

PDB Entry: 1yvb, 2.7 Å

PDB Description: the plasmodium falciparum cysteine protease falcipain-2

PDB Compounds: (A:) falcipain 2

SCOP Domain Sequences for d1yvba1:

Sequence; same for both SEQRES and ATOM records:

>d1yvba1 d.3.1.1 (A:0-212) Falcipain 2 {Plasmodium falciparum [TaxId: 5833]}
qmnyeevikkyrgeenfdhaaydwrlhsgvtpvkdqkncgscwafssigsvesqyairkn
klitlseqelvdcsfknygcngglinnafedmielggicpdgdypyvsdapnlcnidrct
ekygiknylsvpdnklkealrflgpisisvavsddfafykegifdgecgdqlnhavmlvg
fgmkeivnpltkkgekhyyyiiknswgqqwgergfinietdesglmrkcglgtdafipli
e

Timeline for d1yvba1:

• d1yvba1 first appeared in SCOP 1.73
  
• d1yvba1 appears in SCOPe 2.01
  
• d1yvba1 appears in the current release, SCOPe 2.08