SCOP 1.75: Domain d1yvbi1: 1yvb I:9-116

Lineage for d1yvbi1 (1yvb I:9-116)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.17: Cystatin-like [54402] (7 superfamilies)
   Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet

4. Superfamily d.17.1: Cystatin/monellin [54403] (6 families)
   has a additional strand at the N-terminus

5. Family d.17.1.2: Cystatins [54407] (6 proteins)

6. Protein Cystatin [54410] (1 species)

7. Species Chicken (Gallus gallus) [TaxId:9031] [54411] (4 PDB entries)

8. Domain d1yvbi1: 1yvb I:9-116 [124093]
   Other proteins in same PDB: d1yvba1
   automatically matched to d1a67__
   complexed with gol

Details for d1yvbi1

PDB Entry: 1yvb, 2.7 Å

PDB Description: the plasmodium falciparum cysteine protease falcipain-2

PDB Compounds: (I:) cystatin

SCOP Domain Sequences for d1yvbi1:

Sequence; same for both SEQRES and ATOM records:

>d1yvbi1 d.17.1.2 (I:9-116) Cystatin {Chicken (Gallus gallus) [TaxId: 9031]}
gapvpvdendeglqralqfamaeynrasndkyssrvvrvisakrqlvsgikyilqveigr
ttcpkssgdlqscefhdepemakyttctfvvysipwlnqiklleskcq

Timeline for d1yvbi1:

• d1yvbi1 first appeared in SCOP 1.73
  
• d1yvbi1 is called d1yvbi_ in SCOPe 2.01
  
• d1yvbi1 appears in the current release, SCOPe 2.08, called d1yvbi_