![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.25: Ferritin-like [47239] (6 superfamilies) core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection |
![]() | Superfamily a.25.1: Ferritin-like [47240] (10 families) ![]() contains bimetal-ion centre in the middle of the bundle |
![]() | Family a.25.1.1: Ferritin [47241] (10 proteins) |
![]() | Protein Nigerythrin, N-terminal domain [140440] (1 species) |
![]() | Species Desulfovibrio vulgaris [TaxId:881] [140441] (3 PDB entries) Uniprot P30820 1-166 |
![]() | Domain d1yv1b1: 1yv1 B:1-166 [124086] Other proteins in same PDB: d1yv1a2, d1yv1b2 automated match to d1yuxa1 complexed with fe2 |
PDB Entry: 1yv1 (more details), 1.5 Å
SCOPe Domain Sequences for d1yv1b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yv1b1 a.25.1.1 (B:1-166) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]} mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets dmypafirkaqeegnskavhvftraklaesvhaerylaayndidap
Timeline for d1yv1b1: