SCOPe 2.06: Domain d1yv1b1: 1yv1 B:1-166

Lineage for d1yv1b1 (1yv1 B:1-166)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.25: Ferritin-like [47239] (6 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (10 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (10 proteins)

6. Protein Nigerythrin, N-terminal domain [140440] (1 species)

7. Species Desulfovibrio vulgaris [TaxId:881] [140441] (3 PDB entries)
   Uniprot P30820 1-166

8. Domain d1yv1b1: 1yv1 B:1-166 [124086]
   Other proteins in same PDB: d1yv1a2, d1yv1b2
   automated match to d1yuxa1
   complexed with fe2

Details for d1yv1b1

PDB Entry: 1yv1, 1.5 Å

PDB Description: Fully reduced state of nigerythrin (all ferrous)

PDB Compounds: (B:) Nigerythrin

SCOPe Domain Sequences for d1yv1b1:

Sequence; same for both SEQRES and ATOM records:

>d1yv1b1 a.25.1.1 (B:1-166) Nigerythrin, N-terminal domain {Desulfovibrio vulgaris [TaxId: 881]}
mkvraqvptvknatnfnmvadsktsvgstlenlkaaiagetgahakytafakaareqgye
qiarlfeataaaelihigleyalvaemepgyekptvaapsayscdlnlisgangeiyets
dmypafirkaqeegnskavhvftraklaesvhaerylaayndidap

Timeline for d1yv1b1:

• d1yv1b1 first appeared in SCOP 1.73
  
• d1yv1b1 appears in SCOPe 2.05
  
• d1yv1b1 appears in SCOPe 2.07
  
• d1yv1b1 appears in the current release, SCOPe 2.08