Class h: Coiled coil proteins [57942] (7 folds) |
Fold h.1: Parallel coiled-coil [57943] (41 superfamilies) this is not a true fold; includes oligomers of shorter identical helices |
Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) form heterodimeric coiled coil |
Family h.1.25.1: Troponin T [90251] (1 protein) |
Protein Troponin T [90252] (2 species) |
Species Chicken (Gallus gallus) [TaxId:9031] [144262] (2 PDB entries) Uniprot P12620 159-248 |
Domain d1yv0t1: 1yv0 T:164-248 [124083] Other proteins in same PDB: d1yv0c1, d1yv0i1 automatically matched to 1YTZ T:159-248 complexed with mg |
PDB Entry: 1yv0 (more details), 7 Å
SCOPe Domain Sequences for d1yv0t1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yv0t1 h.1.25.1 (T:164-248) Troponin T {Chicken (Gallus gallus) [TaxId: 9031]} lakadqkrgkkqtaretkkkvlaerrkplnidhlnedklrdkakelwdwlyqlqtekydf aeqikrkkyeivtlrnridqaqkhs
Timeline for d1yv0t1: