Lineage for d1yv0t1 (1yv0 T:164-248)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040519Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) (S)
    form heterodimeric coiled coil
  5. 3040520Family h.1.25.1: Troponin T [90251] (1 protein)
  6. 3040521Protein Troponin T [90252] (2 species)
  7. 3040522Species Chicken (Gallus gallus) [TaxId:9031] [144262] (2 PDB entries)
    Uniprot P12620 159-248
  8. 3040524Domain d1yv0t1: 1yv0 T:164-248 [124083]
    Other proteins in same PDB: d1yv0c1, d1yv0i1
    automatically matched to 1YTZ T:159-248
    complexed with mg

Details for d1yv0t1

PDB Entry: 1yv0 (more details), 7 Å

PDB Description: crystal structure of skeletal muscle troponin in the ca2+-free state
PDB Compounds: (T:) Troponin T, fast skeletal muscle isoforms

SCOPe Domain Sequences for d1yv0t1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yv0t1 h.1.25.1 (T:164-248) Troponin T {Chicken (Gallus gallus) [TaxId: 9031]}
lakadqkrgkkqtaretkkkvlaerrkplnidhlnedklrdkakelwdwlyqlqtekydf
aeqikrkkyeivtlrnridqaqkhs

SCOPe Domain Coordinates for d1yv0t1:

Click to download the PDB-style file with coordinates for d1yv0t1.
(The format of our PDB-style files is described here.)

Timeline for d1yv0t1: