Lineage for d1yv0c1 (1yv0 C:3-161)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1994319Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1994320Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1994753Family a.39.1.5: Calmodulin-like [47502] (24 protein domains)
    Duplication: made with two pairs of EF-hands
  6. 1995233Protein Troponin C [47503] (6 species)
  7. 1995234Species Chicken (Gallus gallus) [TaxId:9031] [47504] (28 PDB entries)
    Uniprot P09860
  8. 1995265Domain d1yv0c1: 1yv0 C:3-161 [124081]
    Other proteins in same PDB: d1yv0i1, d1yv0t1
    automatically matched to d1ncx__
    complexed with mg

Details for d1yv0c1

PDB Entry: 1yv0 (more details), 7 Å

PDB Description: Crystal structure of skeletal muscle troponin in the Ca2+-free state
PDB Compounds: (C:) troponin c, skeletal muscle

SCOPe Domain Sequences for d1yv0c1:

Sequence, based on SEQRES records: (download)

>d1yv0c1 a.39.1.5 (C:3-161) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie
evdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilr
atgehvteediedlmkdsdknndgridfdeflkmmegvq

Sequence, based on observed residues (ATOM records): (download)

>d1yv0c1 a.39.1.5 (C:3-161) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]}
tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie
evdedgsgtidfeeflvmmvrqelancfrifdknadgfidieelgeilratgehvteedi
edlmkdsdknndgridfdeflkmmegvq

SCOPe Domain Coordinates for d1yv0c1:

Click to download the PDB-style file with coordinates for d1yv0c1.
(The format of our PDB-style files is described here.)

Timeline for d1yv0c1: