SCOPe 2.06: Domain d1yt8a3: 1yt8 A:373-529

Lineage for d1yt8a3 (1yt8 A:373-529)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (4 proteins)
   duplication: consists of two domains of this fold

6. Protein Thiosulfate sulfurtransferase PA2603 [142351] (1 species)

7. Species Pseudomonas aeruginosa [TaxId:287] [142352] (1 PDB entry)
   Uniprot Q9I0N4 105-240! Uniprot Q9I0N4 241-370! Uniprot Q9I0N4 371-527! Uniprot Q9I0N4 4-104

8. Domain d1yt8a3: 1yt8 A:373-529 [123998]
   Other proteins in same PDB: d1yt8a5
   complexed with gol, so3

Details for d1yt8a3

PDB Entry: 1yt8, 1.9 Å

PDB Description: crystal structure of thiosulfate sulfurtransferase from pseudomonas aeruginosa

PDB Compounds: (A:) thiosulfate sulfurtransferase

SCOPe Domain Sequences for d1yt8a3:

Sequence; same for both SEQRES and ATOM records:

>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}
qpradtidpttladwlgepgtrvldftasanyakrhipgaawvlrsqlkqalerlgtaer
yvltcgssllarfavaevqalsgkpvflldggtsawvaaglptedgesllaspridryrr
pyegtdnpreamqgyldwefglveqlgrdgthgffvi

Timeline for d1yt8a3:

• d1yt8a3 first appeared in SCOP 1.73
  
• d1yt8a3 appears in SCOPe 2.05
  
• d1yt8a3 appears in SCOPe 2.07
  
• d1yt8a3 appears in the current release, SCOPe 2.08