Lineage for d1yt8a3 (1yt8 A:373-529)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876007Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2876008Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 2876043Family c.46.1.2: Multidomain sulfurtransferase (rhodanese) [52827] (5 proteins)
    duplication: consists of two domains of this fold
  6. 2876080Protein Thiosulfate sulfurtransferase PA2603 [142351] (1 species)
  7. 2876081Species Pseudomonas aeruginosa [TaxId:287] [142352] (1 PDB entry)
    Uniprot Q9I0N4 105-240! Uniprot Q9I0N4 241-370! Uniprot Q9I0N4 371-527! Uniprot Q9I0N4 4-104
  8. 2876084Domain d1yt8a3: 1yt8 A:373-529 [123998]
    Other proteins in same PDB: d1yt8a5
    complexed with gol, so3

Details for d1yt8a3

PDB Entry: 1yt8 (more details), 1.9 Å

PDB Description: crystal structure of thiosulfate sulfurtransferase from pseudomonas aeruginosa
PDB Compounds: (A:) thiosulfate sulfurtransferase

SCOPe Domain Sequences for d1yt8a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yt8a3 c.46.1.2 (A:373-529) Thiosulfate sulfurtransferase PA2603 {Pseudomonas aeruginosa [TaxId: 287]}
qpradtidpttladwlgepgtrvldftasanyakrhipgaawvlrsqlkqalerlgtaer
yvltcgssllarfavaevqalsgkpvflldggtsawvaaglptedgesllaspridryrr
pyegtdnpreamqgyldwefglveqlgrdgthgffvi

SCOPe Domain Coordinates for d1yt8a3:

Click to download the PDB-style file with coordinates for d1yt8a3.
(The format of our PDB-style files is described here.)

Timeline for d1yt8a3: