| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.60: SAM domain-like [47768] (16 superfamilies) 4-5 helices; bundle of two orthogonally packed alpha-hairpins; involved in the interactions with DNA and proteins |
Superfamily a.60.8: HRDC-like [47819] (4 families) ![]() |
| Family a.60.8.3: RNase D C-terminal domains [140643] (1 protein) tandem repeat of two domains of this fold, the first domain belongs to Pfam PF00570 |
| Protein Ribonuclease D [140644] (1 species) |
| Species Escherichia coli [TaxId:562] [140645] (1 PDB entry) Uniprot P09155 194-294! Uniprot P09155 295-375 |
| Domain d1yt3a2: 1yt3 A:295-375 [123993] Other proteins in same PDB: d1yt3a3 complexed with so4, zn |
PDB Entry: 1yt3 (more details), 1.6 Å
SCOPe Domain Sequences for d1yt3a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yt3a2 a.60.8.3 (A:295-375) Ribonuclease D {Escherichia coli [TaxId: 562]}
lnlmdmpgyrkafkaikslitdvsethkisaellasrrqinqllnwhwklkpqnnlpeli
sgwrgelmaealhnllqeypq
Timeline for d1yt3a2: