SCOPe 2.07: Domain d1ysya1: 1ysy A:3-85

Lineage for d1ysya1 (1ysy A:3-85)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold

4. Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families)

5. Family a.8.9.1: Coronavirus NSP7-like [140368] (2 proteins)
   automatically mapped to Pfam PF08716

6. Protein Nonstructural protein 7, NSP7 [140369] (1 species)

7. Species SARS coronavirus [TaxId:227859] [140370] (2 PDB entries)
   Uniprot P59641 3837-3909! Uniprot P59641 3837-3919

8. Domain d1ysya1: 1ysy A:3-85 [123986]
   Other proteins in same PDB: d1ysya2

Details for d1ysya1

PDB Entry: 1ysy

PDB Description: nmr structure of the nonstructural protein 7 (nsp7) from the sars coronavirus

PDB Compounds: (A:) Replicase polyprotein 1ab (pp1ab) (ORF1AB)

SCOPe Domain Sequences for d1ysya1:

Sequence; same for both SEQRES and ATOM records:

>d1ysya1 a.8.9.1 (A:3-85) Nonstructural protein 7, NSP7 {SARS coronavirus [TaxId: 227859]}
skmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsvll
smqgavdinrlceemldnratlq

Timeline for d1ysya1:

• d1ysya1 first appeared in SCOP 1.73
  
• d1ysya1 appears in SCOPe 2.06
  
• d1ysya1 appears in the current release, SCOPe 2.08