Lineage for d1ysya1 (1ysy A:3-85)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2696962Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2697307Superfamily a.8.9: Coronavirus NSP7-like [140367] (2 families) (S)
  5. 2697308Family a.8.9.1: Coronavirus NSP7-like [140368] (2 proteins)
    automatically mapped to Pfam PF08716
  6. 2697309Protein Nonstructural protein 7, NSP7 [140369] (1 species)
  7. 2697310Species SARS coronavirus [TaxId:227859] [140370] (2 PDB entries)
    Uniprot P59641 3837-3909! Uniprot P59641 3837-3919
  8. 2697312Domain d1ysya1: 1ysy A:3-85 [123986]
    Other proteins in same PDB: d1ysya2

Details for d1ysya1

PDB Entry: 1ysy (more details)

PDB Description: nmr structure of the nonstructural protein 7 (nsp7) from the sars coronavirus
PDB Compounds: (A:) Replicase polyprotein 1ab (pp1ab) (ORF1AB)

SCOPe Domain Sequences for d1ysya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ysya1 a.8.9.1 (A:3-85) Nonstructural protein 7, NSP7 {SARS coronavirus [TaxId: 227859]}
skmsdvkctsvvllsvlqqlrvesssklwaqcvqlhndillakdtteafekmvsllsvll
smqgavdinrlceemldnratlq

SCOPe Domain Coordinates for d1ysya1:

Click to download the PDB-style file with coordinates for d1ysya1.
(The format of our PDB-style files is described here.)

Timeline for d1ysya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ysya2