SCOPe 2.04: Domain d1yswa_: 1ysw A:

Lineage for d1yswa_ (1ysw A:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein Bcl-2 [64524] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [64525] (9 PDB entries)

8. Domain d1yswa_: 1ysw A: [123984]
   automated match to d2o22a1
   complexed with 43b

Details for d1yswa_

PDB Entry: 1ysw

PDB Description: solution structure of the anti-apoptotic protein bcl-2 complexed with an acyl-sulfonamide-based ligand

PDB Compounds: (A:) Apoptosis regulator Bcl-2

SCOPe Domain Sequences for d1yswa_:

Sequence; same for both SEQRES and ATOM records:

>d1yswa_ f.1.4.1 (A:) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]}
hagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagdd
fsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvn
remsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsmr

Timeline for d1yswa_:

• d1yswa_ first appeared in SCOP 1.73, called d1yswa1
  
• d1yswa_ was called d1yswa1 in SCOPe 2.03
  
• d1yswa_ appears in SCOPe 2.05
  
• d1yswa_ appears in the current release, SCOPe 2.08, called d1yswa2