![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies) multi-helical domains of various folds which is thought to unfold in the membrane |
![]() | Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families) ![]() PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain |
![]() | Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins) Pfam PF00452 |
![]() | Protein Bcl-2 [64524] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [64525] (18 PDB entries) |
![]() | Domain d1yswa2: 1ysw A:1-203 [123984] Other proteins in same PDB: d1yswa3 automated match to d2o22a1 complexed with 43b has additional insertions and/or extensions that are not grouped together |
PDB Entry: 1ysw (more details)
SCOPe Domain Sequences for d1yswa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yswa2 f.1.4.1 (A:1-203) Bcl-2 {Human (Homo sapiens) [TaxId: 9606]} hagrtgydnreivmkyihyklsqrgyewdagddveenrteapegtesevvhltlrqagdd fsrryrrdfaemssqlhltpftargrfatvveelfrdgvnwgrivaffefggvmcvesvn remsplvdnialwmteylnrhlhtwiqdnggwdafvelygpsm
Timeline for d1yswa2: