SCOPe 2.06: Domain d1ys7b1: 1ys7 B:128-233

Lineage for d1ys7b1 (1ys7 B:128-233)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.1: PhoB-like [46895] (5 proteins)
   contains 4-stranded meander beta-sheet in the N-terminal extension

6. Protein Transcriptional regulatory protein PrrA [140315] (1 species)

7. Species Mycobacterium tuberculosis [TaxId:1773] [140316] (2 PDB entries)
   Uniprot P0A5Z6 128-233

8. Domain d1ys7b1: 1ys7 B:128-233 [123963]
   Other proteins in same PDB: d1ys7a2, d1ys7b2
   automated match to d1ys6a1
   complexed with act, gol, mg, trs

Details for d1ys7b1

PDB Entry: 1ys7, 1.58 Å

PDB Description: crystal structure of the response regulator protein prra complexed with mg2+

PDB Compounds: (B:) Transcriptional regulatory protein prrA

SCOPe Domain Sequences for d1ys7b1:

Sequence, based on SEQRES records:

>d1ys7b1 a.4.6.1 (B:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}
statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel
vwgydfaadtnvvdvfigylrrkleagggprllhtvrgvgfvlrmq

Sequence, based on observed residues (ATOM records):

>d1ys7b1 a.4.6.1 (B:128-233) Transcriptional regulatory protein PrrA {Mycobacterium tuberculosis [TaxId: 1773]}
statsssetitvgplevdipgrrarvngvdvdltkrefdllavlaehktavlsraqllel
vwgydfaadtnvvdvfigylrrkleaggprllhtvrgvgfvlrmq

Timeline for d1ys7b1:

• d1ys7b1 first appeared in SCOP 1.73
  
• d1ys7b1 appears in SCOPe 2.05
  
• d1ys7b1 appears in SCOPe 2.07
  
• d1ys7b1 appears in the current release, SCOPe 2.08