![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.1: CheY-like [52172] (8 families) ![]() |
![]() | Family c.23.1.1: CheY-related [52173] (26 proteins) |
![]() | Protein Transcriptional regulatory protein PrrA, N-terminal domain [142031] (1 species) |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [142032] (2 PDB entries) Uniprot P0A5Z6 7-127 |
![]() | Domain d1ys7b2: 1ys7 B:7-127 [123964] Other proteins in same PDB: d1ys7a1, d1ys7b1 automated match to d1ys6a2 complexed with act, gol, mg, trs |
PDB Entry: 1ys7 (more details), 1.58 Å
SCOPe Domain Sequences for d1ys7b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ys7b2 c.23.1.1 (B:7-127) Transcriptional regulatory protein PrrA, N-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} sprvlvvdddsdvlaslerglrlsgfevatavdgaealrsatenrpdaivldinmpvldg vsvvtalramdndvpvcvlsarssvddrvagleagaddylvkpfvlaelvarvkallrrr g
Timeline for d1ys7b2: