Lineage for d1yrwa1 (1yrw A:204-300)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1545250Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
    barrel, open; n*=6, S*=10; greek-key
  4. 1545251Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families) (S)
  5. 1545252Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)
  6. 1545267Protein Polymyxin resistance protein ArnA, domain 2 [141381] (1 species)
  7. 1545268Species Escherichia coli [TaxId:562] [141382] (4 PDB entries)
    Uniprot P77398 201-304! Uniprot P77398 204-304
  8. 1545271Domain d1yrwa1: 1yrw A:204-300 [123942]
    Other proteins in same PDB: d1yrwa2
    automated match to d2blna1

Details for d1yrwa1

PDB Entry: 1yrw (more details), 1.7 Å

PDB Description: Crystal Structure of E.coli ArnA Transformylase Domain
PDB Compounds: (A:) protein ArnA

SCOPe Domain Sequences for d1yrwa1:

Sequence, based on SEQRES records: (download)

>d1yrwa1 b.46.1.1 (A:204-300) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvisva
plliacgdgaleivtgqagdgitmqgsqlaqtlglvq

Sequence, based on observed residues (ATOM records): (download)

>d1yrwa1 b.46.1.1 (A:204-300) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhpkaqpgsvisvapll
iacgdgaleivtgqagdgitmqgsqlaqtlglvq

SCOPe Domain Coordinates for d1yrwa1:

Click to download the PDB-style file with coordinates for d1yrwa1.
(The format of our PDB-style files is described here.)

Timeline for d1yrwa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yrwa2