SCOPe 2.05: Domain d1yrwa1: 1yrw A:204-300

Lineage for d1yrwa1 (1yrw A:204-300)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.46: FMT C-terminal domain-like [50485] (1 superfamily)
   barrel, open; n*=6, S*=10; greek-key

4. Superfamily b.46.1: FMT C-terminal domain-like [50486] (3 families)

5. Family b.46.1.1: Post formyltransferase domain [50487] (3 proteins)

6. Protein Polymyxin resistance protein ArnA, domain 2 [141381] (1 species)

7. Species Escherichia coli [TaxId:562] [141382] (4 PDB entries)
   Uniprot P77398 201-304! Uniprot P77398 204-304

8. Domain d1yrwa1: 1yrw A:204-300 [123942]
   Other proteins in same PDB: d1yrwa2
   automated match to d2blna1

Details for d1yrwa1

PDB Entry: 1yrw, 1.7 Å

PDB Description: Crystal Structure of E.coli ArnA Transformylase Domain

PDB Compounds: (A:) protein ArnA

SCOPe Domain Sequences for d1yrwa1:

Sequence, based on SEQRES records:

>d1yrwa1 b.46.1.1 (A:204-300) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhphaskaqpgsvisva
plliacgdgaleivtgqagdgitmqgsqlaqtlglvq

Sequence, based on observed residues (ATOM records):

>d1yrwa1 b.46.1.1 (A:204-300) Polymyxin resistance protein ArnA, domain 2 {Escherichia coli [TaxId: 562]}
ddsflewhkpasvlhnmvravadpwpgafsyvgnqkftvwssrvhpkaqpgsvisvapll
iacgdgaleivtgqagdgitmqgsqlaqtlglvq

Timeline for d1yrwa1:

• d1yrwa1 first appeared in SCOP 1.73
  
• d1yrwa1 appears in SCOPe 2.04
  
• d1yrwa1 appears in SCOPe 2.06
  
• d1yrwa1 appears in the current release, SCOPe 2.08