Lineage for d1yrod_ (1yro D:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1178199Fold c.68: Nucleotide-diphospho-sugar transferases [53447] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214657; strand 6 is antiparallel to the rest
  4. 1178200Superfamily c.68.1: Nucleotide-diphospho-sugar transferases [53448] (20 families) (S)
  5. 1178209Family c.68.1.2: beta 1,4 galactosyltransferase (b4GalT1) [53452] (2 proteins)
  6. 1178210Protein beta 1,4 galactosyltransferase (b4GalT1) [53453] (1 species)
  7. 1178211Species Cow (Bos taurus) [TaxId:9913] [53454] (19 PDB entries)
    Uniprot P08037 131-402
  8. 1178214Domain d1yrod_: 1yro D: [123934]
    Other proteins in same PDB: d1yroa_, d1yroc_
    automated match to d1o0rb_
    complexed with ca, gdu, mes, mn, pg4, udp; mutant

Details for d1yrod_

PDB Entry: 1yro (more details), 1.9 Å

PDB Description: crystal structure of beta14,-galactosyltransferase mutant arg228lys in complex with alpha-lactalbumin in the presence of udp-galactose and mn
PDB Compounds: (D:) beta-1,4-galactosyltransferase

SCOPe Domain Sequences for d1yrod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yrod_ c.68.1.2 (D:) beta 1,4 galactosyltransferase (b4GalT1) {Cow (Bos taurus) [TaxId: 9913]}
ltacpeespllvgpmliefnipvdlklveqqnpkvklggrytpmdcisphkvaiiipfrn
rqehlkywlyylhpilqrqqldygiyvinqagesmfnkakllnvgfkealkdydyncfvf
sdvdlipmndhntyrcfsqprhisvamdkfgfslpyvqyfggvsalskqqflsingfpnn
ywgwggedddiynrlafrgmsvsrpnavigktrmirhsrdkknepnpqrfdriahtketm
lsdglnsltymvlevqryplytkitvdigtps

SCOPe Domain Coordinates for d1yrod_:

Click to download the PDB-style file with coordinates for d1yrod_.
(The format of our PDB-style files is described here.)

Timeline for d1yrod_: