Lineage for d1yroa_ (1yro A:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1190374Fold d.2: Lysozyme-like [53954] (1 superfamily)
    common alpha+beta motif for the active site region
  4. 1190375Superfamily d.2.1: Lysozyme-like [53955] (12 families) (S)
  5. 1190400Family d.2.1.2: C-type lysozyme [53960] (3 proteins)
  6. 1190401Protein alpha-Lactalbumin [53975] (6 species)
    expressed only in the lactating mammary gland, strongly binds calcium ion
  7. 1190433Species Mouse (Mus musculus) [TaxId:10090] [69628] (12 PDB entries)
  8. 1190434Domain d1yroa_: 1yro A: [123931]
    Other proteins in same PDB: d1yrob1, d1yrod_
    automated match to d1nf5a_
    complexed with ca, gdu, mes, mn, pg4, udp; mutant

Details for d1yroa_

PDB Entry: 1yro (more details), 1.9 Å

PDB Description: crystal structure of beta14,-galactosyltransferase mutant arg228lys in complex with alpha-lactalbumin in the presence of udp-galactose and mn
PDB Compounds: (A:) alpha-lactalbumin

SCOPe Domain Sequences for d1yroa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yroa_ d.2.1.2 (A:) alpha-Lactalbumin {Mouse (Mus musculus) [TaxId: 10090]}
teltkckvshaikdidgyqgisllewacvlfhtsgydtqavvndngsteyglfqisdrfw
ckssefpesenicgiscdkllddeldddiacakkilaikgidywkaykpmcsekleqwrc
ekp

SCOPe Domain Coordinates for d1yroa_:

Click to download the PDB-style file with coordinates for d1yroa_.
(The format of our PDB-style files is described here.)

Timeline for d1yroa_: