SCOPe 2.04: Domain d1yqya1: 1yqy A:551-778

Lineage for d1yqya1 (1yqy A:551-778)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
   automatically mapped to Pfam PF07737

6. Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
   duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries)

8. Domain d1yqya1: 1yqy A:551-778 [123903]
   Other proteins in same PDB: d1yqya2
   automated match to d1j7na2
   complexed with 915, zn

Details for d1yqya1

PDB Entry: 1yqy, 2.3 Å

PDB Description: Structure of B. Anthrax Lethal factor in complex with a hydroxamate inhibitor

PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d1yqya1:

Sequence; same for both SEQRES and ATOM records:

>d1yqya1 d.92.1.14 (A:551-778) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiinslv

Timeline for d1yqya1:

• d1yqya1 first appeared in SCOP 1.73
  
• d1yqya1 appears in SCOPe 2.03
  
• d1yqya1 appears in SCOPe 2.05
  
• d1yqya1 appears in the current release, SCOPe 2.08