Lineage for d1yqya1 (1yqy A:551-778)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1917420Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 1917421Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families) (S)
  5. 1918408Family d.92.1.14: Anthrax toxin lethal factor, N- and C-terminal domains [69775] (2 proteins)
    automatically mapped to Pfam PF07737
  6. 1918409Protein Anthrax toxin lethal factor, N- and C-terminal domains [69776] (1 species)
    duplication: each domain adopts a thermolysin-like fold, but the proteolytic activity resides only in the C-terminal domain
  7. 1918410Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [69777] (9 PDB entries)
  8. 1918411Domain d1yqya1: 1yqy A:551-778 [123903]
    Other proteins in same PDB: d1yqya2
    automated match to d1j7na2
    complexed with 915, zn

Details for d1yqya1

PDB Entry: 1yqy (more details), 2.3 Å

PDB Description: Structure of B. Anthrax Lethal factor in complex with a hydroxamate inhibitor
PDB Compounds: (A:) Lethal Factor

SCOPe Domain Sequences for d1yqya1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yqya1 d.92.1.14 (A:551-778) Anthrax toxin lethal factor, N- and C-terminal domains {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
pkskidtkiqeaqlninqewnkalglpkytklitfnvhnryasnivesaylilnewknni
qsdlikkvtnylvdgngrfvftditlpniaeqythqdeiyeqvhskglyvpesrsillhg
pskgvelrndsegfihefghavddyagylldknqsdlvtnskkfidifkeegsnltsygr
tneaeffaeafrlmhstdhaerlkvqknapktfqfindqikfiinslv

SCOPe Domain Coordinates for d1yqya1:

Click to download the PDB-style file with coordinates for d1yqya1.
(The format of our PDB-style files is described here.)

Timeline for d1yqya1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1yqya2