Lineage for d1ypof1 (1ypo F:142-270)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1226319Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1226320Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1226321Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 1226562Protein Oxidised low density lipoprotein [143955] (1 species)
  7. 1226563Species Human (Homo sapiens) [TaxId:9606] [143956] (2 PDB entries)
    Uniprot P78380 140-270
  8. 1226570Domain d1ypof1: 1ypo F:142-270 [123830]
    automatically matched to 1YPQ A:140-270

Details for d1ypof1

PDB Entry: 1ypo (more details), 3 Å

PDB Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 P3 1 21 Space Group
PDB Compounds: (F:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1ypof1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypof1 d.169.1.1 (F:142-270) Oxidised low density lipoprotein {Human (Homo sapiens) [TaxId: 9606]}
apcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp
fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf
sicqkkanl

SCOPe Domain Coordinates for d1ypof1:

Click to download the PDB-style file with coordinates for d1ypof1.
(The format of our PDB-style files is described here.)

Timeline for d1ypof1: