![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
![]() | Superfamily d.169.1: C-type lectin-like [56436] (9 families) ![]() |
![]() | Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
![]() | Protein automated matches [190159] (21 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries) |
![]() | Domain d1ypof_: 1ypo F: [123830] Other proteins in same PDB: d1ypob3, d1ypoc3, d1ypog3 automated match to d1yxja_ |
PDB Entry: 1ypo (more details), 3 Å
SCOPe Domain Sequences for d1ypof_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ypof_ d.169.1.0 (F:) automated matches {Human (Homo sapiens) [TaxId: 9606]} mapcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssf pfwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaa fsicqkkanl
Timeline for d1ypof_: