Lineage for d1ypod_ (1ypo D:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3001353Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 3001354Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 3002276Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 3002277Protein automated matches [190159] (21 species)
    not a true protein
  7. 3002332Species Human (Homo sapiens) [TaxId:9606] [186882] (109 PDB entries)
  8. 3002606Domain d1ypod_: 1ypo D: [123828]
    Other proteins in same PDB: d1ypob3, d1ypoc3, d1ypog3
    automated match to d1yxja_

Details for d1ypod_

PDB Entry: 1ypo (more details), 3 Å

PDB Description: Human Oxidized Low Density Lipoprotein Receptor LOX-1 P3 1 21 Space Group
PDB Compounds: (D:) oxidised low density lipoprotein (lectin-like) receptor 1

SCOPe Domain Sequences for d1ypod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ypod_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
apcpqdwiwhgencylfssgsfnweksqekclsldakllkinstadldfiqqaisyssfp
fwmglsrrnpsypwlwedgsplmphlfrvrgavsqtypsgtcayiqrgavyaencilaaf
sicqkkanl

SCOPe Domain Coordinates for d1ypod_:

Click to download the PDB-style file with coordinates for d1ypod_.
(The format of our PDB-style files is described here.)

Timeline for d1ypod_: