![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.5: Flavoproteins [52218] (9 families) ![]() |
![]() | Family c.23.5.1: Flavodoxin-related [52219] (6 proteins) binds FMN |
![]() | Protein Flavodoxin [52220] (10 species) |
![]() | Species Azotobacter vinelandii [TaxId:354] [142046] (1 PDB entry) Uniprot P00324 1-179 |
![]() | Domain d1yoba1: 1yob A:1-179 [123776] Other proteins in same PDB: d1yobb_ complexed with fmn, so4 |
PDB Entry: 1yob (more details), 2.25 Å
SCOPe Domain Sequences for d1yoba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]} akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg elpglssdaenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl
Timeline for d1yoba1: