Structural Classification of Proteins and ASTRAL release 1.75B (January 2013)
Search SCOP (example):

Lineage for d1yoba1 (1yob A:1-179)

  1. Root: SCOP 1.75B
  2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. Superfamily c.23.5: Flavoproteins [52218] (9 families) (S)
  5. Family c.23.5.1: Flavodoxin-related [52219] (6 protein domains)
    binds FMN
  6. Protein Flavodoxin [52220] (9 species)
  7. Species Azotobacter vinelandii [TaxId:354] [142046] (1 PDB entry)
    Uniprot P00324 1-179
  8. Domain d1yoba1: 1yob A:1-179 [123776]
    Other proteins in same PDB: d1yobb_
    complexed with fmn, so4

Details for d1yoba1

PDB Entry: 1yob (more details)
PDB Description: c69a flavodoxin ii from azotobacter vinelandii
PDB Compounds: (A:) Flavodoxin 2

SCOP Domain Sequences for d1yoba1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]}
akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg
elpglssdaenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr
gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl

SCOP Domain Coordinates for d1yoba1:

Click to download the PDB-style file with coordinates for d1yoba1.
(The format of our PDB-style files is described here.)

Timeline for d1yoba1:

d1yoba1 appears in SCOP 1.75A


d1yoba1
(click for larger image)


d1yoba1 in context of chain



d1yoba1 in context of PDB
Domains from other chains:
d1yobb_

SCOP Copyright © 1994-2013 The SCOP and Astral authors
scop@mrc-lmb.cam.ac.uk and astral@compbio.berkeley.edu