Lineage for d1yoba1 (1yob A:1-179)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.5: Flavoproteins [52218] (9 families) 
Family c.23.5.1: Flavodoxin-related [52219] (6 proteins)
binds FMN
Protein Flavodoxin [52220] (11 species) 
Species Azotobacter vinelandii [TaxId:354] [142046] (1 PDB entry)
Uniprot P00324 1-179
Domain d1yoba1: 1yob A:1-179 [123776]
Other proteins in same PDB: d1yobb_
complexed with fmn, so4
Details for d1yoba1
PDB Entry: 1yob (more details), 2.25 Å
PDB Description: c69a flavodoxin ii from azotobacter vinelandii
PDB Compounds: (A:) Flavodoxin 2SCOPe Domain Sequences for d1yoba1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1yoba1 c.23.5.1 (A:1-179) Flavodoxin {Azotobacter vinelandii [TaxId: 354]}
akiglffgsntgktrkvaksikkrfddetmsdalnvnrvsaedfaqyqflilgtptlgeg
elpglssdaenesweeflpkiegldfsgktvalfglgdqvgypenyldalgelysffkdr
gakivgswstdgyefesseavvdgkfvglaldldnqsgktdervaawlaqiapefglsl
SCOPe Domain Coordinates for d1yoba1:
Click to download the PDB-style file with coordinates for d1yoba1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1yoba1:
- d1yoba1 first appeared in SCOP 1.73
- d1yoba1 appears in SCOPe 2.07
View in 3D
