SCOPe 2.02: Domain d1ynwb1: 1ynw B:235-300

Lineage for d1ynwb1 (1ynw B:235-300)

1. Root: SCOPe 2.02

2. Class g: Small proteins [56992] (90 folds)

3. Fold g.39: Glucocorticoid receptor-like (DNA-binding domain) [57715] (1 superfamily)
   alpha+beta metal(zinc)-bound fold

4. Superfamily g.39.1: Glucocorticoid receptor-like (DNA-binding domain) [57716] (19 families)

5. Family g.39.1.2: Nuclear receptor [57721] (13 proteins)
   duplication: two zinc-binding motifs

6. Protein Retinoid X receptor (RXR-alpha) DNA-binding domain [57722] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [57723] (6 PDB entries)

8. Domain d1ynwb1: 1ynw B:235-300 [123763]
   Other proteins in same PDB: d1ynwa1
   automatically matched to d2nlla_
   protein/DNA complex; complexed with zn

Details for d1ynwb1

PDB Entry: 1ynw, 3 Å

PDB Description: crystal structure of vitamin d receptor and 9-cis retinoic acid receptor dna-binding domains bound to a dr3 response element

PDB Compounds: (B:) Retinoic acid receptor RXR-alpha

SCOPe Domain Sequences for d1ynwb1:

Sequence; same for both SEQRES and ATOM records:

>d1ynwb1 g.39.1.2 (B:235-300) Retinoid X receptor (RXR-alpha) DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
caicgdrssgkhygvyscegckgffkrtvrkdltytcrdnkdclidkrqrnrcqycryqk
clamgm

Timeline for d1ynwb1:

• d1ynwb1 first appeared in SCOP 1.73
  
• d1ynwb1 appears in SCOPe 2.01
  
• d1ynwb1 appears in SCOPe 2.03
  
• d1ynwb1 appears in the current release, SCOPe 2.08, called d1ynwb_