SCOP 1.73: Domain d1yntg1: 1ynt G:3003-3131

Lineage for d1yntg1 (1ynt G:3003-3131)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands

4. Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family)
   SS-crosslinked beta-sandwich of distinct geometry but topologically similar to cupredoxins

5. Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (1 protein)

6. Protein Major surface antigen p30, SAG1 [74879] (1 species)
   duplication: tandem repeat of two homologous domains

7. Species Toxoplasma gondii [TaxId:5811] [74880] (2 PDB entries)

8. Domain d1yntg1: 1ynt G:3003-3131 [123760]
   Other proteins in same PDB: d1yntb1, d1yntd1, d1ynte1
   automatically matched to d1kzqa1
   complexed with cd

Details for d1yntg1

PDB Entry: 1ynt, 3.1 Å

PDB Description: structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab

PDB Compounds: (G:) Major Surface Antigen P30

SCOP Domain Sequences for d1yntg1:

Sequence; same for both SEQRES and ATOM records:

>d1yntg1 b.6.2.1 (G:3003-3131) Major surface antigen p30, SAG1 {Toxoplasma gondii [TaxId: 5811]}
plvanqvvtcpdkkstaaviltptenhftlkcpktaltepptlayspnrqicpagttssc
tskavtlsslipeaedswwtgdsasldtagikltvpiekfpvttqtfvvgcikgddaqsc
mvtvtvqar

Timeline for d1yntg1:

• d1yntg1 is new in SCOP 1.73
  
• d1yntg1 appears in SCOP 1.75
  
• d1yntg1 appears in the current release, SCOPe 2.08