SCOP 1.73: Domain d1ynte1: 1ynt E:820-880

Lineage for d1ynte1 (1ynt E:820-880)

1. Root: SCOP 1.73

2. Class d: Alpha and beta proteins (a+b) [53931] (334 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (13 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.7: Immunoglobulin-binding domains [54358] (1 family)

5. Family d.15.7.1: Immunoglobulin-binding domains [54359] (2 proteins)

6. Protein Immunoglobulin light chain-binding domain of protein L [54362] (1 species)

7. Species Peptostreptococcus magnus [TaxId:1260] [54363] (12 PDB entries)

8. Domain d1ynte1: 1ynt E:820-880 [123757]
   Other proteins in same PDB: d1yntb1, d1yntd1, d1yntf1, d1yntf2, d1yntg1, d1yntg2
   automatically matched to d1heze_
   complexed with cd

Details for d1ynte1

PDB Entry: 1ynt, 3.1 Å

PDB Description: structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab

PDB Compounds: (E:) protein l

SCOP Domain Sequences for d1ynte1:

Sequence; same for both SEQRES and ATOM records:

>d1ynte1 d.15.7.1 (E:820-880) Immunoglobulin light chain-binding domain of protein L {Peptostreptococcus magnus [TaxId: 1260]}
evtikvnlifadgkiqtaefkgtfeeataeayryadllakvngeytadledggnhmnikf
a

Timeline for d1ynte1:

• d1ynte1 is new in SCOP 1.73
  
• d1ynte1 appears in SCOP 1.75
  
• d1ynte1 appears in the current release, SCOPe 2.08, called d1ynte_