Lineage for d1yntg2 (1ynt G:3132-3254)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 660498Fold b.6: Cupredoxin-like [49502] (2 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands
  4. 661394Superfamily b.6.2: Major surface antigen p30, SAG1 [74877] (1 family) (S)
    SS-crosslinked beta-sandwich of distinct geometry but topologically similar to cupredoxins
  5. 661395Family b.6.2.1: Major surface antigen p30, SAG1 [74878] (1 protein)
  6. 661396Protein Major surface antigen p30, SAG1 [74879] (1 species)
    duplication: tandem repeat of two homologous domains
  7. 661397Species Toxoplasma gondii [TaxId:5811] [74880] (2 PDB entries)
  8. 661405Domain d1yntg2: 1ynt G:3132-3254 [123761]
    Other proteins in same PDB: d1yntb1, d1yntd1, d1ynte1
    automatically matched to d1kzqa2
    complexed with cd

Details for d1yntg2

PDB Entry: 1ynt (more details), 3.1 Å

PDB Description: structure of the monomeric form of t. gondii sag1 surface antigen bound to a human fab
PDB Compounds: (G:) Major Surface Antigen P30

SCOP Domain Sequences for d1yntg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yntg2 b.6.2.1 (G:3132-3254) Major surface antigen p30, SAG1 {Toxoplasma gondii [TaxId: 5811]}
assvvnnvarcsygadstlgpvklsaegpttmtlvcgkdgvkvpqdnnqycsgttltgcn
eksfkdilpkltenpwqgnassdkgatltikkeafpaesksviigctggspekhhctvkl
efa

SCOP Domain Coordinates for d1yntg2:

Click to download the PDB-style file with coordinates for d1yntg2.
(The format of our PDB-style files is described here.)

Timeline for d1yntg2: