SCOPe 2.07: Domain d1ynrc_: 1ynr C:

Lineage for d1ynrc_ (1ynr C:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Cytochrome c552 [46636] (6 species)

7. Species Hydrogenobacter thermophilus [TaxId:940] [46640] (9 PDB entries)

8. Domain d1ynrc_: 1ynr C: [123752]
   automated match to d1ayg__
   complexed with hec, mpd, so4

Details for d1ynrc_

PDB Entry: 1ynr, 2 Å

PDB Description: Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution

PDB Compounds: (C:) Cytochrome c-552

SCOPe Domain Sequences for d1ynrc_:

Sequence; same for both SEQRES and ATOM records:

>d1ynrc_ a.3.1.1 (C:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsik

Timeline for d1ynrc_:

• d1ynrc_ first appeared in SCOP 1.73, called d1ynrc1
  
• d1ynrc_ appears in SCOPe 2.06
  
• d1ynrc_ appears in the current release, SCOPe 2.08