Lineage for d1ynrc_ (1ynr C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2690796Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 2690797Superfamily a.3.1: Cytochrome c [46626] (9 families) (S)
    covalently-bound heme completes the core
  5. 2690798Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)
  6. 2690913Protein Cytochrome c552 [46636] (6 species)
  7. 2690914Species Hydrogenobacter thermophilus [TaxId:940] [46640] (9 PDB entries)
  8. 2690924Domain d1ynrc_: 1ynr C: [123752]
    automated match to d1ayg__
    complexed with hec, mpd, so4

Details for d1ynrc_

PDB Entry: 1ynr (more details), 2 Å

PDB Description: Crystal structure of the cytochrome c-552 from Hydrogenobacter thermophilus at 2.0 resolution
PDB Compounds: (C:) Cytochrome c-552

SCOPe Domain Sequences for d1ynrc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ynrc_ a.3.1.1 (C:) Cytochrome c552 {Hydrogenobacter thermophilus [TaxId: 940]}
neqlakqkgcmachdlkakkvgpayadvakkyagrkdavdylagkikkggsgvwgsvpmp
pqnvtdaeakqlaqwilsik

SCOPe Domain Coordinates for d1ynrc_:

Click to download the PDB-style file with coordinates for d1ynrc_.
(The format of our PDB-style files is described here.)

Timeline for d1ynrc_: