Lineage for d1yn7b_ (1yn7 B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1513477Protein beta2-microglobulin [88600] (5 species)
  7. 1514079Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries)
    Uniprot P01887
  8. 1514168Domain d1yn7b_: 1yn7 B: [123717]
    Other proteins in same PDB: d1yn7a1, d1yn7a2
    automated match to d1bz9b_

Details for d1yn7b_

PDB Entry: 1yn7 (more details), 2.2 Å

PDB Description: crystal structure of a mouse mhc class i protein, h2-db, in complex with a mutated peptide (r7a) of the influenza a acid polymerase
PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1yn7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yn7b_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
miqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskd
wsfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1yn7b_:

Click to download the PDB-style file with coordinates for d1yn7b_.
(The format of our PDB-style files is described here.)

Timeline for d1yn7b_: