SCOPe 2.08: Domain d1yn7b2: 1yn7 B:1-99

Lineage for d1yn7b2 (1yn7 B:1-99)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (7 species)

7. Species Mouse (Mus musculus) [TaxId:10090] [88603] (222 PDB entries)
   Uniprot P01887

8. Domain d1yn7b2: 1yn7 B:1-99 [123717]
   Other proteins in same PDB: d1yn7a1, d1yn7a2, d1yn7b3
   automated match to d1bz9b_

Details for d1yn7b2

PDB Entry: 1yn7, 2.2 Å

PDB Description: crystal structure of a mouse mhc class i protein, h2-db, in complex with a mutated peptide (r7a) of the influenza a acid polymerase

PDB Compounds: (B:) Beta-2-microglobulin

SCOPe Domain Sequences for d1yn7b2:

Sequence; same for both SEQRES and ATOM records:

>d1yn7b2 b.1.1.2 (B:1-99) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

Timeline for d1yn7b2:

• d1yn7b2 first appeared in SCOP 1.73, called d1yn7b1
  
• d1yn7b2 appears in SCOPe 2.07