Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.108: HAD-like [56783] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456 |
Superfamily c.108.1: HAD-like [56784] (26 families) usually contains an insertion (sub)domain after strand 1 |
Family c.108.1.10: Predicted hydrolases Cof [82388] (12 proteins) contains an alpha+beta subdomain inserted into a new site after strand 3 |
Protein Sugar-phosphate phosphatase BT4131 [142157] (1 species) |
Species Bacteroides thetaiotaomicron [TaxId:818] [142158] (5 PDB entries) Uniprot Q8A090 2-261 |
Domain d1ymqa1: 1ymq A:2-261 [123707] complexed with mg, so4 |
PDB Entry: 1ymq (more details), 1.9 Å
SCOPe Domain Sequences for d1ymqa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ymqa1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} tkalffdidgtlvsfethripsstiealeaahakglkifiatgrpkaiinnlselqdrnl idgyitmngaycfvgeeviyksaipqeevkamaafcekkgvpcifveehnisvcqpnemv kkifydflhvnviptvsfeeasnkeviqmtpfiteeeekevlpsiptceigrwypafadv takgdtkqkgideiirhfgikleetmsfgdggndismlrhaaigvamgqakedvkaaady vtapidedgiskamkhfgii
Timeline for d1ymqa1: