Lineage for d1ymqa1 (1ymq A:2-261)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 712195Fold c.108: HAD-like [56783] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 712196Superfamily c.108.1: HAD-like [56784] (23 families) (S)
    usually contains an insertion (sub)domain after strand 1
  5. 712401Family c.108.1.10: Predicted hydrolases Cof [82388] (11 proteins)
    contains an alpha+beta subdomain inserted into a new site after strand 3
  6. 712469Protein Sugar-phosphate phosphatase BT4131 [142157] (1 species)
  7. 712470Species Bacteroides thetaiotaomicron [TaxId:818] [142158] (1 PDB entry)
  8. 712471Domain d1ymqa1: 1ymq A:2-261 [123707]
    complexed with mg, so4

Details for d1ymqa1

PDB Entry: 1ymq (more details), 1.9 Å

PDB Description: had superfamily phosphotransferase substrate diversification: structure and function analysis of the had subclass iib sugar phosphatase bt4131
PDB Compounds: (A:) sugar-phosphate phosphatase BT4131

SCOP Domain Sequences for d1ymqa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymqa1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]}
tkalffdidgtlvsfethripsstiealeaahakglkifiatgrpkaiinnlselqdrnl
idgyitmngaycfvgeeviyksaipqeevkamaafcekkgvpcifveehnisvcqpnemv
kkifydflhvnviptvsfeeasnkeviqmtpfiteeeekevlpsiptceigrwypafadv
takgdtkqkgideiirhfgikleetmsfgdggndismlrhaaigvamgqakedvkaaady
vtapidedgiskamkhfgii

SCOP Domain Coordinates for d1ymqa1:

Click to download the PDB-style file with coordinates for d1ymqa1.
(The format of our PDB-style files is described here.)

Timeline for d1ymqa1: