PDB entry 1ymq

View 1ymq on RCSB PDB site
Description: HAD Superfamily Phosphotransferase Substrate Diversification: Structure and Function Analysis of the HAD Subclass IIB Sugar Phosphatase BT4131
Class: transferase
Keywords: HAD superfamily phosphotransferase, TRANSFERASE
Deposited on 2005-01-21, released 2005-06-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.173
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: sugar-phosphate phosphatase BT4131
    Species: BACTEROIDES THETAIOTAOMICRON [TaxId:226186]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d1ymqa1
  • Heterogens: MG, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ymqA (A:)
    mtkalffdidgtlvsfethripsstiealeaahakglkifiatgrpkaiinnlselqdrn
    lidgyitmngaycfvgeeviyksaipqeevkamaafcekkgvpcifveehnisvcqpnem
    vkkifydflhvnviptvsfeeasnkeviqmtpfiteeeekevlpsiptceigrwypafad
    vtakgdtkqkgideiirhfgikleetmsfgdggndismlrhaaigvamgqakedvkaaad
    yvtapidedgiskamkhfgii
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ymqA (A:)
    tkalffdidgtlvsfethripsstiealeaahakglkifiatgrpkaiinnlselqdrnl
    idgyitmngaycfvgeeviyksaipqeevkamaafcekkgvpcifveehnisvcqpnemv
    kkifydflhvnviptvsfeeasnkeviqmtpfiteeeekevlpsiptceigrwypafadv
    takgdtkqkgideiirhfgikleetmsfgdggndismlrhaaigvamgqakedvkaaady
    vtapidedgiskamkhfgii