Lineage for d1ymma2 (1ymm A:13-81)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2937550Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
    dimeric
  4. 2937551Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families) (S)
  5. 2937552Family d.19.1.1: MHC antigen-recognition domain [54453] (13 proteins)
  6. 2938226Protein Class II MHC alpha chain, N-terminal domain [88806] (15 species)
  7. 2938324Species Mouse (Mus musculus), I-AU [TaxId:10090] [89859] (13 PDB entries)
  8. 2938343Domain d1ymma2: 1ymm A:13-81 [123702]
    Other proteins in same PDB: d1ymma1, d1ymmb1, d1ymmb2, d1ymmd1, d1ymme1, d1ymme2
    automatically matched to d1k2da2
    complexed with nag

    fragment; missing more than one-third of the common structure and/or sequence

Details for d1ymma2

PDB Entry: 1ymm (more details), 3.5 Å

PDB Description: tcr/hla-dr2b/mbp-peptide complex
PDB Compounds: (A:) hla class II histocompatibility antigen, dr alpha chain

SCOPe Domain Sequences for d1ymma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ymma2 d.19.1.1 (A:13-81) Class II MHC alpha chain, N-terminal domain {Mouse (Mus musculus), I-AU [TaxId: 10090]}
ylnpdqsgefmfdfdgdeifhvdmakketvwrleefgrfasfeaqgalaniavdkanlei
mtkrsnytp

SCOPe Domain Coordinates for d1ymma2:

Click to download the PDB-style file with coordinates for d1ymma2.
(The format of our PDB-style files is described here.)

Timeline for d1ymma2: