Lineage for d1ym9a_ (1ym9 A:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2483944Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451
  4. 2483945Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families) (S)
    Pfam PF00581
    the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology
  5. 2483946Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins)
  6. 2483950Protein CDC25b [52825] (1 species)
  7. 2483951Species Human (Homo sapiens) [TaxId:9606] [52826] (14 PDB entries)
  8. 2483965Domain d1ym9a_: 1ym9 A: [123697]
    automated match to d1cwra_
    complexed with cl

Details for d1ym9a_

PDB Entry: 1ym9 (more details), 2 Å

PDB Description: crystal structure of the cdc25b phosphatase catalytic domain with the active site cysteine in the sulfinic form
PDB Compounds: (A:) M-phase inducer phosphatase 2

SCOPe Domain Sequences for d1ym9a_:

Sequence, based on SEQRES records: (download)

>d1ym9a_ c.46.1.1 (A:) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdravn
dypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw

Sequence, based on observed residues (ATOM records): (download)

>d1ym9a_ c.46.1.1 (A:) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
meligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyegg
hiktavnlplerdaesfllkspiapkrvilifhcefssergprmcrfirerdravndyps
lyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw

SCOPe Domain Coordinates for d1ym9a_:

Click to download the PDB-style file with coordinates for d1ym9a_.
(The format of our PDB-style files is described here.)

Timeline for d1ym9a_: