SCOPe 2.08: Domain d1ym9a2: 1ym9 A:377-550

Lineage for d1ym9a2 (1ym9 A:377-550)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.46: Rhodanese/Cell cycle control phosphatase [52820] (1 superfamily)
   3 layers: a/b/a; parallel beta-sheet of 5 strands, order 32451

4. Superfamily c.46.1: Rhodanese/Cell cycle control phosphatase [52821] (5 families)
   Pfam PF00581
   the active site structure is similar to those of the families I and II protein phosphatases; the topology can be related by a different circular permutation to the family I topology

5. Family c.46.1.1: Cell cycle control phosphatase, catalytic domain [52822] (5 proteins)

6. Protein CDC25b [52825] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52826] (14 PDB entries)

8. Domain d1ym9a2: 1ym9 A:377-550 [123697]
   Other proteins in same PDB: d1ym9a3
   automated match to d1cwra_
   complexed with cl

Details for d1ym9a2

PDB Entry: 1ym9, 2 Å

PDB Description: crystal structure of the cdc25b phosphatase catalytic domain with the active site cysteine in the sulfinic form

PDB Compounds: (A:) M-phase inducer phosphatase 2

SCOPe Domain Sequences for d1ym9a2:

Sequence, based on SEQRES records:

>d1ym9a2 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
eligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyeggh
iktavnlplerdaesfllkspiapcsldkrvilifhcefssergprmcrfirerdravnd
ypslyypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw

Sequence, based on observed residues (ATOM records):

>d1ym9a2 c.46.1.1 (A:377-550) CDC25b {Human (Homo sapiens) [TaxId: 9606]}
eligdyskafllqtvdgkhqdlkyispetmvalltgkfsnivdkfvivdcrypyeyeggh
iktavnlplerdaesfllkspiapkrvilifhcefssergprmcrfirerdravndypsl
yypemyilkggykeffpqhpnfcepqdyrpmnheafkdelktfrlktrsw

Timeline for d1ym9a2:

• d1ym9a2 first appeared in SCOP 1.73, called d1ym9a1
  
• d1ym9a2 was called d1ym9a_ in SCOPe 2.07