SCOPe 2.08: Domain d1ylxa1: 1ylx A:1-100

Lineage for d1ylxa1 (1ylx A:1-100)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
   alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet

4. Superfamily d.82.5: GK1464-like [143579] (1 family)
   dimer; pseudo barrel; the true dimeric barrel formation requires swapping of the C-ternimal beta-alpha units

5. Family d.82.5.1: GK1464-like [143580] (2 proteins)

6. Protein Hypothetical protein, GK1464 ortholog [143581] (1 species)
   MCSG target ID: APC35702

7. Species Bacillus stearothermophilus [TaxId:1422] [143582] (1 PDB entry)
   Uniprot Q5KZY7 1-100

8. Domain d1ylxa1: 1ylx A:1-100 [123677]
   Other proteins in same PDB: d1ylxb_

Details for d1ylxa1

PDB Entry: 1ylx, 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function from Bacillus stearothermophilus

PDB Compounds: (A:) hypothetical protein APC35702

SCOPe Domain Sequences for d1ylxa1:

Sequence; same for both SEQRES and ATOM records:

>d1ylxa1 d.82.5.1 (A:1-100) Hypothetical protein, GK1464 ortholog {Bacillus stearothermophilus [TaxId: 1422]}
mefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitihmpf
vknergelalekqewtvrkdgrekkgfhslqeameevihs

Timeline for d1ylxa1:

• d1ylxa1 first appeared in SCOP 1.73
  
• d1ylxa1 appears in SCOPe 2.07