Lineage for d1ylxa1 (1ylx A:1-100)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2527780Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2527886Superfamily d.82.5: GK1464-like [143579] (1 family) (S)
    dimer; pseudo barrel; the true dimeric barrel formation requires swapping of the C-ternimal beta-alpha units
  5. 2527887Family d.82.5.1: GK1464-like [143580] (2 proteins)
  6. 2527888Protein Hypothetical protein, GK1464 ortholog [143581] (1 species)
    MCSG target ID: APC35702
  7. 2527889Species Bacillus stearothermophilus [TaxId:1422] [143582] (1 PDB entry)
    Uniprot Q5KZY7 1-100
  8. 2527890Domain d1ylxa1: 1ylx A:1-100 [123677]
    Other proteins in same PDB: d1ylxb_

Details for d1ylxa1

PDB Entry: 1ylx (more details), 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function from Bacillus stearothermophilus
PDB Compounds: (A:) hypothetical protein APC35702

SCOPe Domain Sequences for d1ylxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylxa1 d.82.5.1 (A:1-100) Hypothetical protein, GK1464 ortholog {Bacillus stearothermophilus [TaxId: 1422]}
mefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitihmpf
vknergelalekqewtvrkdgrekkgfhslqeameevihs

SCOPe Domain Coordinates for d1ylxa1:

Click to download the PDB-style file with coordinates for d1ylxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ylxa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ylxb_