Lineage for d1ylxa1 (1ylx A:1-100)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 728433Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 728490Superfamily d.82.5: GK1464-like [143579] (1 family) (S)
    dimer; pseudo barrel; the true dimeric barrel formation requires swapping of the C-ternimal beta-alpha units
  5. 728491Family d.82.5.1: GK1464-like [143580] (1 protein)
  6. 728492Protein Hypothetical protein, GK1464 ortholog [143581] (1 species)
    MCSG target ID: APC35702
  7. 728493Species Bacillus stearothermophilus [TaxId:1422] [143582] (1 PDB entry)
  8. 728494Domain d1ylxa1: 1ylx A:1-100 [123677]

Details for d1ylxa1

PDB Entry: 1ylx (more details), 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function from Bacillus stearothermophilus
PDB Compounds: (A:) hypothetical protein APC35702

SCOP Domain Sequences for d1ylxa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylxa1 d.82.5.1 (A:1-100) Hypothetical protein, GK1464 ortholog {Bacillus stearothermophilus [TaxId: 1422]}
mefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitihmpf
vknergelalekqewtvrkdgrekkgfhslqeameevihs

SCOP Domain Coordinates for d1ylxa1:

Click to download the PDB-style file with coordinates for d1ylxa1.
(The format of our PDB-style files is described here.)

Timeline for d1ylxa1:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ylxb1