Lineage for d1ylxb_ (1ylx B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2962266Fold d.82: N domain of copper amine oxidase-like [55382] (5 superfamilies)
    alpha-beta(5)-alpha; 2 layers: alpha/beta; meander antiparallel sheet
  4. 2962382Superfamily d.82.5: GK1464-like [143579] (1 family) (S)
    dimer; pseudo barrel; the true dimeric barrel formation requires swapping of the C-ternimal beta-alpha units
  5. 2962383Family d.82.5.1: GK1464-like [143580] (2 proteins)
  6. 2962387Protein automated matches [190832] (1 species)
    not a true protein
  7. 2962388Species Geobacillus stearothermophilus [TaxId:1422] [188138] (1 PDB entry)
  8. 2962389Domain d1ylxb_: 1ylx B: [123678]
    Other proteins in same PDB: d1ylxa1
    automated match to d1ylxa1

Details for d1ylxb_

PDB Entry: 1ylx (more details), 1.6 Å

PDB Description: Crystal Structure of a Protein of Unknown Function from Bacillus stearothermophilus
PDB Compounds: (B:) hypothetical protein APC35702

SCOPe Domain Sequences for d1ylxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylxb_ d.82.5.1 (B:) automated matches {Geobacillus stearothermophilus [TaxId: 1422]}
mefaprsvvieefidtlepmmeaygldqvgifeehgegnryyvgytinkddemitihmpf
vknergelalekqewtvrkdgrekkgfhslqeameevihs

SCOPe Domain Coordinates for d1ylxb_:

Click to download the PDB-style file with coordinates for d1ylxb_.
(The format of our PDB-style files is described here.)

Timeline for d1ylxb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1ylxa1