Lineage for d1ylia_ (1yli A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550606Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2550709Protein Putative acyl-coa thioester hydrolase HI0827 [102903] (1 species)
  7. 2550710Species Haemophilus influenzae [TaxId:727] [102904] (1 PDB entry)
  8. 2550711Domain d1ylia_: 1yli A: [123651]
    automated match to d1nngb_
    complexed with ca, coa, gol

Details for d1ylia_

PDB Entry: 1yli (more details), 1.95 Å

PDB Description: crystal structure of hi0827, a hexameric broad specificity acyl- coenzyme a thioesterase
PDB Compounds: (A:) Putative acyl-CoA thioester hydrolase HI0827

SCOPe Domain Sequences for d1ylia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ylia_ d.38.1.1 (A:) Putative acyl-coa thioester hydrolase HI0827 {Haemophilus influenzae [TaxId: 727]}
rqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvavesmnfi
kpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfvavdnngr
srtiprennqelekalaliseq

SCOPe Domain Coordinates for d1ylia_:

Click to download the PDB-style file with coordinates for d1ylia_.
(The format of our PDB-style files is described here.)

Timeline for d1ylia_: