Lineage for d1nngb_ (1nng B:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2550604Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily)
    core: beta-alpha-beta(4); 2 layers: alpha/beta
  4. 2550605Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (9 families) (S)
  5. 2550606Family d.38.1.1: 4HBT-like [54638] (19 proteins)
    Pfam PF03061
  6. 2550713Protein automated matches [190155] (3 species)
    not a true protein
  7. 2550727Species Haemophilus influenzae [TaxId:71421] [188352] (2 PDB entries)
  8. 2550735Domain d1nngb_: 1nng B: [302772]
    automated match to d1ylib_
    complexed with ca, coa, gol

Details for d1nngb_

PDB Entry: 1nng (more details), 1.95 Å

PDB Description: Structure of HI0827, a thioesterase acting on short-chain acyl-CoA compounds.
PDB Compounds: (B:) Putative acyl-CoA thioester hydrolase HI0827

SCOPe Domain Sequences for d1nngb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nngb_ d.38.1.1 (B:) automated matches {Haemophilus influenzae [TaxId: 71421]}
ftdkngrqskgvlllrtlampsdtnangdifggwimsqmdmggailakeiahgrvvtvav
esmnfikpisvgdvvccygqclkvgrssikikvevwvkkvasepigerycvtdavftfva
vdnngrsrtiprennqelekalaliseq

SCOPe Domain Coordinates for d1nngb_:

Click to download the PDB-style file with coordinates for d1nngb_.
(The format of our PDB-style files is described here.)

Timeline for d1nngb_: